Anti-Tryptophan 5 hydroxylase 2 antibody [CL2990] - C-terminal (ab211528)

Overview

  • Product name

    Anti-Tryptophan 5 hydroxylase 2 antibody [CL2990] - C-terminal
  • Description

    Mouse monoclonal [CL2990] to Tryptophan 5 hydroxylase 2 - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Horse, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human Tryptophan 5 hydroxylase 2 aa 438-489 (C terminal).
    Sequence:

    SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQY LG


    Database link: Q8IWU9

  • Positive control

    • Human dorsal raphe and cerebral cortex tissue; rat dorsal raphe and cerebral cortex tissue: mouse basal forebrain and cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab211528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Brain specific.
  • Pathway

    Aromatic compound metabolism; serotonin biosynthesis; serotonin from L-tryptophan: step 1/2.
  • Involvement in disease

    Genetic variation in TPH2 may influence susceptibility to major depressive disorder (MDD) [MIM:608516].
    Defects in TPH2 are the cause of susceptibility to attention deficit-hyperactivity disorder type 7 (ADHD7) [MIM:613003]. ADHD is a neurobehavioral developmental disorder and is primarily characterized by the co-existence of attentional problems and hyperactivity, with each behavior occurring infrequently alone. Note=Naturally occurring variants of TPH2 with impaired enzyme activity could cause deficiency of serotonin production and result in an increased risk of developing behavioral disorders.
  • Sequence similarities

    Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
    Contains 1 ACT domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 1.14.16.4 antibody
    • FLJ37295 antibody
    • MGC138871 antibody
    • MGC138872 antibody
    • Neuronal tryptophan hydroxylase antibody
    • NTPH antibody
    • TPH 2 antibody
    • Tph2 antibody
    • TPH2_HUMAN antibody
    • Tryptophan 5 monooxygenase 2 antibody
    • Tryptophan 5-hydroxylase 2 antibody
    • Tryptophan 5-monooxygenase 2 antibody
    • Tryptophan hydroxylase 2 antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded human cerebral cortex tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded mouse cerebral cortex tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded rat cerebral cortex tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded human dorsal raphe tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded mouse basal forebrain tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded rat dorsal raphe tissue labeling Tryptophan 5 hydroxylase 2 with ab211528 at 1/1000 dilution.

References

ab211528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up