Overview

  • Product name

    Anti-Tryptophan Hydroxylase/TPH antibody
    See all Tryptophan Hydroxylase/TPH primary antibodies
  • Description

    Rabbit polyclonal to Tryptophan Hydroxylase/TPH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse Tryptophan Hydroxylase/TPH aa 1-447.
    Sequence:

    MIEDNKENKENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLH IESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTA KEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKY FAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNL PLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAF RVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLAS LGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSG HAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPF GLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALARVTRWPSV


    Database link: P17532

  • Positive control

    • ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Tryptophan Hydroxylase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Isoform 2 seems to be less widely expressed than isoform 1.
  • Pathway

    Aromatic compound metabolism; serotonin biosynthesis; serotonin from L-tryptophan: step 1/2.
  • Sequence similarities

    Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
    Contains 1 ACT domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Indoleacetic acid 5 hydroxylase antibody
    • L tryptophan hydroxylase antibody
    • MGC119994 antibody
    • TPH 1 antibody
    • TPH antibody
    • TPH1 antibody
    • TPH1_HUMAN antibody
    • TPRH antibody
    • TRPH antibody
    • Tryptophan 5 hydroxylase 1 antibody
    • Tryptophan 5 monooxygenase 1 antibody
    • Tryptophan 5 monooxygenase antibody
    • Tryptophan 5-hydroxylase 1 antibody
    • Tryptophan 5-monooxygenase 1 antibody
    • Tryptophan hydroxylase 1 antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Tryptophan Hydroxylase/TPH (green) using ab234686 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up