Overview

  • Product name

  • Description

    Rabbit polyclonal to TSC-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TSC-1 aa 31-80 (internal sequence). The exact sequence is proprietary.
    Sequence:

    KTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKW


    Database link: Q9Y258

  • Positive control

    • PC3 cell extract
  • General notes

    Previously labelled as Eotaxin 3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 40% Glycerol, 0.87% Sodium chloride

    PBS is without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 11 kDa.

Target

  • Function

    Chemotactic for eosinophils and basophils. Binds to CCR3.
  • Tissue specificity

    Ubiquitously expressed at low levels in various tissues including heart and ovary.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-C motif chemokine 26 antibody
    • CC chemokine IMAC antibody
    • CCL 26 antibody
    • CCL26 antibody
    • CCL26_HUMAN antibody
    • Chemokine (C C motif) ligand 26 antibody
    • chemokine N1 antibody
    • Eotaxin 3 antibody
    • Eotaxin-3 antibody
    • IMAC antibody
    • Macrophage inflammatory protein 4-alpha antibody
    • MIP 4a antibody
    • MIP 4alpha antibody
    • MIP-4-alpha antibody
    • MIP4a antibody
    • MIP4alpha antibody
    • SCYA 26 antibody
    • SCYA26 antibody
    • Small inducible cytokine A26 antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 26 antibody
    • Small inducible cytokine subfamily A member 26 antibody
    • Small-inducible cytokine A26 antibody
    • Thymic stroma chemokine 1 antibody
    • Thymic stroma chemokine-1 antibody
    • TSC 1 antibody
    • TSC-1 antibody
    • TSC1 antibody
    see all

Images

  • Anti-TSC-1 antibody (ab190669) at 1/500 dilution + PC3 cell extract at 30 µg

    Predicted band size: 11 kDa

References

ab190669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up