Overview

  • Product name

    Anti-TSEN34 antibody [OTI6B3]
    See all TSEN34 primary antibodies
  • Description

    Mouse monoclonal [OTI6B3] to TSEN34
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TSEN34 aa 1-310. Produced in E.coli (NP_076980).
    Sequence:

    MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPL LLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSAL AAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDET SDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPL DWRVQSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGD PLRFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQPDGKVV YTSLQWASLQ


    Database link: Q9BSV6

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY TSEN34 cDNA. IHC-P: Human colon adenocarcinoma, kidney carcinoma, lung carcinoma and endometrium tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 34 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Function

    Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.
  • Involvement in disease

    Pontocerebellar hypoplasia 2C
  • Sequence similarities

    Belongs to the tRNA-intron endonuclease family.
  • Cellular localization

    Nucleus. Nucleus, nucleolus. May be transiently localized in the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HsSen34 antibody
    • LENG 5 antibody
    • LENG5 antibody
    • Leukocyte receptor cluster (LRC) member 5 antibody
    • Leukocyte receptor cluster member 5 antibody
    • SEN 34 antibody
    • SEN34 antibody
    • SEN34_HUMAN antibody
    • SEN34L antibody
    • tRNA intron endonuclease Sen34 antibody
    • tRNA splicing endonuclease 34 homolog antibody
    • tRNA splicing endonuclease subunit 34 antibody
    • tRNA splicing endonuclease subunit Sen34 antibody
    • tRNA-intron endonuclease Sen34 antibody
    • tRNA-splicing endonuclease subunit Sen34 antibody
    • TSEN 34 antibody
    • Tsen34 antibody
    see all

Images

  • All lanes : Anti-TSEN34 antibody [OTI6B3] (ab236423) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TSEN34 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

  • Paraffin-embedded human colon adenocarcinoma tissue stained for TSEN34 using ab236423 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney carcinoma tissue stained for TSEN34 using ab236423 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung carcinoma tissue stained for TSEN34 using ab236423 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for TSEN34 using ab236423 at 1/150 dilution in immunohistochemical analysis.

References

ab236423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up