Overview

  • Product name

  • Description

    Rabbit polyclonal to TSGA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TSGA2 aa 149-224.
    Sequence:

    TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEE EEELVTVVPKWKATQITELALWTPTL


    Database link: Q8WYR4

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TSGA2 (Testis specific gene A2), may play an important role in male meiosis. Its expression is restricted to the radial spokes of the axonemes of both sperm and cilia.
  • Cellular localization

    Cytoplasmic. Note: Cytoplasmic in late spermatocytes, secondary spermatocytes and round spermatids. Gathered around metaphase chromosomes during meiotic divisions.
  • Database links

  • Alternative names

    • Cancer/testis antigen 79 antibody
    • CT 79 antibody
    • CT79 antibody
    • FLJ32753 antibody
    • H meichroacidin antibody
    • Male meiotic metaphase chromosome associated acidic protein antibody
    • Meichroacidin antibody
    • MGC126568 antibody
    • MGC141927 antibody
    • Radial spoke head 1 homolog antibody
    • Radial spoke head 1 homolog Chlamydomonas antibody
    • RSP 44 antibody
    • RSP44 antibody
    • RSPH 1 antibody
    • RSPH1 antibody
    • RSPH10A antibody
    • Testes specific A2 homolog antibody
    • Testes specific gene A2 (mouse) homolog antibody
    • Testis specific A2 homolog (mouse) antibody
    • Testis specific A2 homolog antibody
    • Testis specific gene A2 antibody
    • Testis specific gene A2 homolog antibody
    • Testis specific gene A2 protein antibody
    • TSA 2 antibody
    • TSA2 antibody
    • TSGA 2 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TSGA2 with ab224104 (1/50) in immunohistochemical analysis.

References

ab224104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up