Overview

  • Product name

  • Description

    Rabbit polyclonal to TSH beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Dog
    Predicted to work with: Horse, Cow, Cat, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Dog TSH beta aa 20-138. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    SFCFPTEYTMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQ DVCTYRDFMYKTVEIPGCPRHVTPYFSYPVAVSCKCGKCNTDYSDCIHEA IKTNYCTKPQKSYVVGFSI


    Database link: P54828

  • Positive control

    • WB: Recombinant dog TSH beta protein. Dog serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Relevance

    Various hormones are secreted from the anterior pituitary during development and growth. Thyroid Stimulating Hormone (TSH) is secreted from the anterior pituitary and controls thyroid structure and metabolism
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • CHNG4 antibody
    • Thyroid stimulating hormone beta subunit antibody
    • Thyroid stimulating hormone, beta precursor antibody
    • Thyrotropin beta subunit antibody
    • TSHB antibody
    see all

Images

  • Anti-TSH beta antibody (ab231218) at 3 µg/ml + Dog serum

    Secondary
    HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 16 kDa

  • Anti-TSH beta antibody (ab231218) at 2 µg/ml + Recombinant dog TSH beta protein

    Predicted band size: 16 kDa

References

ab231218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up