Overview

  • Product name

    Anti-TSH Receptor/TSH-R antibody
    See all TSH Receptor/TSH-R primary antibodies
  • Description

    Rabbit polyclonal to TSH Receptor/TSH-R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human TSH Receptor/TSH-R aa 21-71 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH A


    Database link: P16473

  • Positive control

    • Raji cell lysate; Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Receptor for thyrothropin. Plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Also acts as a receptor for thyrostimulin (GPA2+GPB5).
  • Tissue specificity

    Expressed in the thyroid.
  • Involvement in disease

    Defects in TSHR are found in patients affected by hyperthyroidism with different etiologies. Somatic, constitutively activating TSHR mutations and/or constitutively activating G(s)alpha mutations have been identified in toxic thyroid nodules (TTNs) that are the predominant cause of hyperthyroidism in iodine deficient areas. These mutations lead to TSH independent activation of the cAMP cascade resulting in thyroid growth and hormone production. TSHR mutations are found in autonomously functioning thyroid nodules (AFTN), toxic multinodular goiter (TMNG) and hyperfunctioning thyroid adenomas (HTA). TMNG encompasses a spectrum of different clinical entities, ranging from a single hyperfunctioning nodule within an enlarged thyroid, to multiple hyperfunctioning areas scattered throughout the gland. HTA are discrete encapsulated neoplasms characterized by TSH-independent autonomous growth, hypersecretion of thyroid hormones, and TSH suppression. Defects in TSHR are also a cause of thyroid neoplasms (papillary and follicular cancers).
    Autoantibodies against TSHR are directly responsible for the pathogenesis and hyperthyroidism of Graves disease. Antibody interaction with TSHR results in an uncontrolled receptor stimulation.
    Hypothyroidism, congenital, non-goitrous, 1
    Familial gestational hyperthyroidism
    Hyperthyroidism, non-autoimmune
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.
    Contains 7 LRR (leucine-rich) repeats.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CHNG1 antibody
    • hTSHR I antibody
    • hTSHRI antibody
    • LGR 3 antibody
    • LGR3 antibody
    • MGC75129 antibody
    • Seven transmembrane helix receptor antibody
    • Thyroid adenoma hyperfunctioning antibody
    • Thyroid carcinoma with thyrotoxicosis antibody
    • Thyroid stimulating hormone receptor antibody
    • Thyroid stimulating hormone receptor, isoform 2 antibody
    • Thyroid-stimulating hormone receptor antibody
    • Thyrotropin receptor antibody
    • Thyrotropin receptor I antibody
    • Thyrotropin receptor I, hTSHR I antibody
    • TSH R antibody
    • TSH Receptor antibody
    • TSH-R antibody
    • TSHR antibody
    • TSHR_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling TSH Receptor/TSH-R with ab214363 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling TSH Receptor/TSH-R with ab214363 at 1/200 dilution overnight at 4°C.  Followed by Goat anti-rabbit IgG, Cy3 conjugated at 1/200 dilution for 40 minutes at 37°C

  • Flow cytometric analysis of Human Raji cell lysate labeling TSH Receptor/TSH-R with ab214363 at 1/50 dilution for 40 minutes followed by a FITC conjugated secondary (green) compared to negative control cells (blue).

References

ab214363 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up