Anti-TSHZ3 antibody (ab224351)
Key features and details
- Rabbit polyclonal to TSHZ3
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TSHZ3 antibody
See all TSHZ3 primary antibodies -
Description
Rabbit polyclonal to TSHZ3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TSHZ3 aa 605-713.
Sequence:TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPI KMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSG STAIITDHP
Database link: Q63HK5 -
Positive control
- IHC-P: Human stomach tissue. ICC/IF: U-2 OS cells.
-
General notes
This product was previously labelled as ZNF537
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224351 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 57616 Human
- SwissProt: Q63HK5 Human
- Unigene: 278436 Human
-
Alternative names
- KIAA1474 antibody
- Teashirt homolog 3 antibody
- TSH3 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-TSHZ3 antibody (ab224351)
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TSHZ3 (green) using ab224351 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TSHZ3 antibody (ab224351)Paraffin-embedded human stomach tissue stained for TSHZ3 using ab224351 at 1/50 in immunohistochemical analysis.
Protocols
Datasheets and documents
References (0)
ab224351 has not yet been referenced specifically in any publications.
