Overview

  • Product name

    Anti-TSPAN5 antibody
  • Description

    Rabbit polyclonal to TSPAN5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human TSPAN5 aa 114-232 (extracellular).
    Sequence:

    VFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWN LNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQ IVIYTKGCVPQFEKWLQDN


    Database link: P62079

  • Positive control

    • WB: Jurkat and A549 whole cell lysate. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-TSPAN5 antibody (ab236881) at 1/1000 dilution

    Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • MCF7 (Human breast adenocarcinoma cell line) cells stained for TSPAN5 (Green) using ab236881 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up