Overview

  • Product name

    Anti-TSPYL5 antibody
  • Description

    Rabbit polyclonal to TSPYL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TSPYL5 aa 263-302 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    ASFLNSQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNP


    Database link: Q86VY4

  • Positive control

    • Mouse embryo tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 45 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Involved in modulation of cell growth and cellular response to gamma radiation probably via regulation of the Akt signaling pathway. Involved in regulation of p53/TP53. Suppresses p53/TP53 protein levels and promotes its ubiquitination; the function is dependent on USP7 and independent on MDM2. Proposed to displace p53/TP53 from interaction with USP7.
  • Sequence similarities

    Belongs to the nucleosome assembly protein (NAP) family.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1750 antibody
    • OTTHUMP00000227724 antibody
    • Testis-specific Y-encoded-like protein 5 antibody
    • TSPY like 5 antibody
    • TSPY-like protein 5 antibody
    • Tspyl5 antibody
    • TSYL5_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling TSPYL5  with ab203657 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab203657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up