Overview

  • Product name

  • Description

    Rabbit polyclonal to TSR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TSR1 aa 155-299.
    Sequence:

    TILFLLDPLEGWDSTGDYCLSCLFAQGLPTYTLAVQGISGLPLKKQIDTR KKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDRRAYLF AHAVDFVPSEENNLVGTLKISGYVRGQTLNVNRLLHIVGYGDFQM


    Database link: Q2NL82

  • Positive control

    • WB: U-251 MG cell lysate. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 92 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.
  • Cellular localization

    Nucleus › nucleolus
  • Database links

  • Alternative names

    • AU040765 antibody
    • AW550801 antibody
    • FLJ10534 antibody
    • KIAA1401 antibody
    • MGC131829 antibody
    • mKIAA1401 antibody
    • OTTMUSP00000006478 antibody
    • Pre-rRNA-processing protein TSR1 homolog antibody
    • RP23-174M12.4 antibody
    • TSR1 ribosome maturation factor antibody
    • TSR1, 20S rRNA accumulation, homolog (S. cerevisiae) antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells labeling ITCH/AIP4 with ab220639 at 4 μg/mL (green).

  • All lanes : Anti-TSR1 antibody (ab220639) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 92 kDa

References

ab220639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up