Overview

  • Product name

  • Description

    Rabbit polyclonal to TSR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TSR2 aa 1-191.
    Sequence:

    MAGAAEDARALFRAGVCAALEAWPALQIAVENGFGGVHSQEKAKWLGGAV EDYFMRNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHF QRGDGAALREMASCITQRKCKVTATALKTARETDEDEDDVDSVEEMEVTA TNDGAATDGVCPQPEPSDPDAQTIKEEDIVEDGWTIVRRKK


    Database link: Q969E8

  • Positive control

    • WB: HEK-293 whole cell lysate. IHC-P: Human lung and heart tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Paraffin-embedded human lung tissue stained for TSR2 with ab237531 at a 1/100 dilution in immunohistochemical analysis.

  • Anti-TSR2 antibody (ab237531) at 1/200 dilution + HEK-293 (Human epithelial cell line from embryonic kidney) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • MCF7 (Human breast adenocarcinoma cell line) cells stained for TSR2 (Green) using ab237531 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human heart tissue stained for TSR2 with ab237531 at a 1/100 dilution in immunohistochemical analysis.

References

ab237531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up