Overview

  • Product name

    Anti-TSSC3 antibody
  • Description

    Rabbit polyclonal to TSSC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TSSC3 aa 1-152.
    Sequence:

    MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKEL RFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALID FQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPR TP


    Database link: Q53GA4

  • Positive control

    • IHC-P: Human prostate cancer and placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids.
  • Tissue specificity

    Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.
  • Sequence similarities

    Belongs to the PHLDA2 family.
    Contains 1 PH domain.
  • Domain

    The PH domain binds phosphoinositides with a broad specificity. It may compete with the PH domain of some other proteins, thereby interfering with their binding to phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-triphosphate (PIP3).
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beckwith Wiedemann syndrome chromosome region 1 candidate protein C antibody
    • Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein antibody
    • BRW 1C antibody
    • BRW1C antibody
    • BWR 1C antibody
    • BWR1C antibody
    • HLDA 2 antibody
    • HLDA2 antibody
    • Imprinted in placenta and liver antibody
    • Imprinted in placenta and liver protein antibody
    • IPL antibody
    • p17 Beckwith Wiedemann region 1C antibody
    • p17 BWR1C antibody
    • p17-Beckwith-Wiedemann region 1 C antibody
    • p17-BWR1C antibody
    • PHLA2_HUMAN antibody
    • PHLDA 2 antibody
    • phlda2 antibody
    • Pleckstrin homology like domain family A member 2 antibody
    • Pleckstrin homology-like domain family A member 2 antibody
    • TSSC 3 antibody
    • Tumor suppressing STF cDNA 3 protein antibody
    • Tumor suppressing subchromosomal transferable fragment candidate gene 3 protein antibody
    • Tumor suppressing subchromosomal transferable fragment cDNA 3 antibody
    • Tumor suppressing subtransferable candidate 3 antibody
    • Tumor supressing STF cDNA 3 antibody
    • Tumor-suppressing STF cDNA 3 protein antibody
    • Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for TSSC3 with ab234669 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for TSSC3 with ab234669 at 1/100 dilution in immunohistochemical analysis.

References

ab234669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up