Overview

  • Product name

    Anti-TSSC4 antibody
  • Description

    Rabbit polyclonal to TSSC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TSSC4 aa 78-159.
    Sequence:

    QPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKRPLA PSGRSPVEGLGRAHRSPASPRVPPVPDYVAHP


    Database link: Q9Y5U2

  • Positive control

    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Expressed in fetal brain, lung, liver and kidney. Widely expressed in adult tissues.
  • Sequence similarities

    Belongs to the TSSC4 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein TSSC4 antibody
    • TSSC4 antibody
    • TSSC4_HUMAN antibody
    • tumor suppressing STF cDNA 4 protein antibody
    • tumor suppressing subchromosomal transferable fragment candidate gene 4 protein antibody
    • tumor suppressing subtransferable candidate 4 antibody
    • Tumor-suppressing STF cDNA 4 protein antibody
    • Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TSSC4 (green) using ab222380 at 4 µg/ml in ICC/IF.

References

ab222380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up