Overview

  • Product name

  • Description

    Rabbit polyclonal to TST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Chinese hamster
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse TST aa 2-297. N-terminal tags. Expressed in E. coli.
    Sequence:

    VHQVLYRALVSTKWLAESIRSGRLGPSLRVLDASWYSPGTRQARKEYQER HVPGASFFDIEECRDTTSPYEMMLPSEAHFGDYVGNLGISNDTHVVVYDG DDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPA VFKATLNLSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDIVGLD SGHIRGSVNMPFMDFLTKDGFEKSPEELRAIFQDKKVDLSQPLIATCRKG VTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA


    Database link: P52196

  • Positive control

    • IHC-P: Mouse kidney and stomach tissue. WB: HepG2 and Wild-type HepG2 whole cell lysate (ab7900). Mouse kidney and liver lysate. Recombinant mouse TST protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/400. Predicted molecular weight: 33 kDa.
IHC-P 1/50 - 1/500.

Target

Images

  • Anti-TST antibody (ab231248) at 1/500 dilution + HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 33 kDa

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for TST with ab231248 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for TST with ab231248 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TST antibody (ab231248) at 1/500 dilution + Mouse liver lysate

    Predicted band size: 33 kDa

  • Anti-TST antibody (ab231248) at 1/500 dilution + Mouse kidney lysate

    Predicted band size: 33 kDa

  • Anti-TST antibody (ab231248) at 1/500 dilution + Recombinant mouse TST protein

    Predicted band size: 33 kDa

References

ab231248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up