Overview

  • Product name

  • Description

    Rabbit polyclonal to TTC19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TTC19 aa 278-371.
    Sequence:

    TIVLMSDLATTLDAQGRFDEAYIYMQRASDLARQINHPELHMVLSNLAAV LMHRERYTQAKEIYQEALKQAKLKKDEISVQHIREELAELSKKS


    Database link: Q6DKK2

  • Positive control

    • RT 4 and U 251 cell lysates; Human liver and tonsil tissue lysates; Human rectum tissue; U 251 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 42 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Mitochondrial protein required for formation of the mitochondrial complex III (PubMed:21278747). May also be required for the abcission step in cytokinesis, possibly regulating the ESCRT-III complex via its interaction with CHMP4B (PubMed:20208530). However, the involvement in cytokinesis requires additional experimental evidence.
  • Involvement in disease

    Mitochondrial complex III deficiency, nuclear 2
  • Sequence similarities

    Belongs to the TTC19 family.
    Contains 5 TPR repeats.
  • Cellular localization

    Mitochondrion inner membrane. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Midbody. According to some authors, localizes to the centrosome during all stages of the cell cycle and is recruited to the midbody during cytokinesis (PubMed:20208530). However, the midbody localization could not be confirmed by others.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2010204O13Rik antibody
    • FLJ20343 antibody
    • MGC138312 antibody
    • MGC19520 antibody
    • mitochondrial antibody
    • RIKEN cDNA 2810460C24 antibody
    • Tetratricopeptide repeat protein 19 antibody
    • TPR repeat protein 19 antibody
    • Ttc 19 antibody
    • TTC19 antibody
    • TTC19_HUMAN antibody
    see all

Images

  • All lanes : Anti-TTC19 antibody (ab204236) at 1/500 dilution

    Lane 1 : RT 4 lysate
    Lane 2 : U 251 cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique.

    Predicted band size: 42 kDa

  • Immunofluorescent analysis of U 251 cells (PFA-fixed/Triton X-100 permeabilized) labeling TTC19 with ab204236 at 4 µg/ml.

  • Immunohistochemical analysis of Paraffin-embedded Human rectum tissue labeling TTC19 with ab204236 at 1/200 dilution.

References

ab204236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up