Overview

  • Product name

  • Description

    Rabbit polyclonal to TTC21A/STI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TTC21A/STI2 aa 1088-1179.
    Sequence:

    QGAESNYMEKKELEQQGVSTAEKLLREFYPHSDSSQTQLRLLQGLCRLAT REKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPK


    Database link: Q8NDW8

  • Positive control

    • IHC-P: Human testis tissue ICC/IF: U-251 MG cells
  • General notes

     This product was previously labelled as TTC21A

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded human testis tissue staining TTC21A/STI2 with ab187748 at 1/1000 dilution.

  • Immunocytochemistry/immunofluorescent analysis of U-251MG cells staining TTC21A/STI2 with ab187748 at 4µg/ml (green). Localisation to the nucleoplasm and centrosome is shown.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue staining TTC21A/STI2 with ab187748 at 1/1000 dilution.

  • Immunohistochemical analysis of Paraffin-embedded Human testis tissue labeling TTC21A/STI2 with ab187748 at 1/200 dilution.

References

ab187748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up