Overview

  • Product name

    Anti-TTC21B antibody
  • Description

    Rabbit polyclonal to TTC21B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TTC21B aa 236-331.
    Sequence:

    QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNA QLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG


    Database link: Q7Z4L5

  • Positive control

    • Human adrenal gland tissue; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May negatively modulate SHH signal transduction and may play a role in retrograde intraflagellar transport in cilia.
  • Sequence similarities

    Belongs to the TTC21 family.
    Contains 19 TPR repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton > cilium axoneme.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATD4 antibody
    • IFT139 antibody
    • JBTS11 antibody
    • Nbla10696 antibody
    • NPHP12 antibody
    • Putative protein product of Nbla10696 antibody
    • SRTD4 antibody
    • Tetratricopeptide repeat protein 21B antibody
    • THM1 antibody
    • TPR repeat protein 21B antibody
    • TT21B_HUMAN antibody
    • Ttc21b antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human adrenal gland tissue labeling TTC21B with ab204373 at 1/200 dilution. 

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling TTC21B with ab204373 at 4 µg/ml (green).

References

ab204373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up