Overview

  • Product name

    Anti-TTC9C antibody
  • Description

    Rabbit polyclonal to TTC9C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human TTC9C aa 1-171.
    Sequence:

    MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP NLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKV LERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQL TQSELSSYHRKEKQLYLGMFG


    Database link: Q8N5M4

  • Positive control

    • WB: THP-1 whole cell lysate. IHC-P: Human breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

Images

  • Paraffin-embedded human breast cancer tissue stained for TTC9C using ab235537 at 1/100 dilution in immunohistochemical analysis.

  • Anti-TTC9C antibody (ab235537) at 1/1000 dilution + THP-1 (Human monocytic leukemia cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

References

ab235537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up