Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free (ab212886)
Key features and details
- Mouse monoclonal [8G7G3/1] to TTF1 - BSA and Azide free
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free
See all TTF1 primary antibodies -
Description
Mouse monoclonal [8G7G3/1] to TTF1 - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant full length protein corresponding to Rat TTF1 aa 1-372.
Sequence:MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPA AAMQQHAVGH HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELP PYQDTMRNSASGPGWYGANPDP RFPAISRFMGPASGMNMSGMGGLGSL GDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF KQQKYLSAPEREHL ASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG GG AGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQ QQAQAAQA AAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAA LQGQVSSLSHLNSSGSDYGA MSCSTLLYGRTW
Database link: P23441 -
Positive control
- Human lung adenocarcinoma tissue; Human thyroid tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 100% PBS -
Carrier free
Yes -
Concentration information loading... -
Purity
Protein A/G purified -
Purification notes
purified from Bioreactor Concentrates -
Clonality
Monoclonal -
Clone number
8G7G3/1 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab212886 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. -
Tissue specificity
Thyroid and lung. -
Involvement in disease
Defects in NKX2-1 are the cause of benign hereditary chorea (BHC) [MIM:118700]; also known as hereditary chorea without dementia. BHC is an autosomal dominant movement disorder. The early onset of symptoms (usully before the age of 5) and the observation that in some BHC families the symptoms tend to decrease in adulthood suggests that the disorder results from a developmental disturbance of the brain. BHC is non-progressive and patients have normal or slightly below normal intelligence. There is considerable inter- and intrafamilial variability, including dysarthria, axial distonia and gait disturbances.
Defects in NKX2-1 are the cause of choreoathetosis, hypothyroidism, and neonatal respiratory distress (CHNRD) [MIM:610978]. This syndrome include neurological, thyroid, and respiratory problems. -
Sequence similarities
Belongs to the NK-2 homeobox family.
Contains 1 homeobox DNA-binding domain. -
Post-translational
modificationsPhosphorylated on serine residues. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 7080 Human
- Entrez Gene: 21869 Mouse
- Entrez Gene: 25628 Rat
- Omim: 600635 Human
- SwissProt: P43699 Human
- SwissProt: P50220 Mouse
- SwissProt: P23441 Rat
- Unigene: 94367 Human
see all -
Alternative names
- AV026640 antibody
- BCH antibody
- Benign chorea antibody
see all
Images
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free (ab212886)](https://www.abcam.com/ps/products/212/ab212886/Images/ab212886-264636-anti-ttf1-antibody-8g7g3-1-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free (ab212886)Immunohistochemical analysisn of formalin fixed, paraffin embedded Human lung adenocarcinoma tissue labeling TTF1 with ab212886 at 1 µg/ml.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free (ab212886)](https://www.abcam.com/ps/products/212/ab212886/Images/ab212886-264638-anti-ttf1-antibody-8g7g3-1-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free (ab212886)Immunohistochemical analysisn of formalin fixed, paraffin embedded Human thyroid tissue labeling TTF1 with ab212886 at 1 µg/ml.
Datasheets and documents
References (0)
ab212886 has not yet been referenced specifically in any publications.
