Overview

  • Product name

    Anti-TTF1 antibody [8G7G3/1] - BSA and Azide free
    See all TTF1 primary antibodies
  • Description

    Mouse monoclonal [8G7G3/1] to TTF1 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Rat TTF1 aa 1-372.
    Sequence:

    MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPA AAMQQHAVGH HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELP PYQDTMRNSASGPGWYGANPDP RFPAISRFMGPASGMNMSGMGGLGSL GDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF KQQKYLSAPEREHL ASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG GG AGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQ QQAQAAQA AAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAA LQGQVSSLSHLNSSGSDYGA MSCSTLLYGRTW


    Database link: P23441

  • Positive control

    • Human lung adenocarcinoma tissue; Human thyroid tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    purified from Bioreactor Concentrates
  • Clonality

    Monoclonal
  • Clone number

    8G7G3/1
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab212886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

in 0.1ml

Target

  • Function

    Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis.
  • Tissue specificity

    Thyroid and lung.
  • Involvement in disease

    Defects in NKX2-1 are the cause of benign hereditary chorea (BHC) [MIM:118700]; also known as hereditary chorea without dementia. BHC is an autosomal dominant movement disorder. The early onset of symptoms (usully before the age of 5) and the observation that in some BHC families the symptoms tend to decrease in adulthood suggests that the disorder results from a developmental disturbance of the brain. BHC is non-progressive and patients have normal or slightly below normal intelligence. There is considerable inter- and intrafamilial variability, including dysarthria, axial distonia and gait disturbances.
    Defects in NKX2-1 are the cause of choreoathetosis, hypothyroidism, and neonatal respiratory distress (CHNRD) [MIM:610978]. This syndrome include neurological, thyroid, and respiratory problems.
  • Sequence similarities

    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AV026640 antibody
    • BCH antibody
    • Benign chorea antibody
    • BHC antibody
    • Homeobox protein NK 2 homolog A antibody
    • Homeobox protein NK-2 homolog A antibody
    • Homeobox protein Nkx 2.1 antibody
    • Homeobox protein Nkx-2.1 antibody
    • Homeobox protein Nkx2.1 antibody
    • NK 2 antibody
    • NK 2 homolog A antibody
    • NK2 antibody
    • NK2 homeobox 1 antibody
    • NK2, drosophila, homolog of, A antibody
    • NK2.1, mouse, homolog of antibody
    • Nkx 2 1 antibody
    • NKX 2.1 antibody
    • NKX 2A antibody
    • NKX2 1 antibody
    • Nkx2-1 antibody
    • NKX2.1 antibody
    • NKX21_HUMAN antibody
    • NKX2A antibody
    • T EBP antibody
    • T/EBP antibody
    • TEBP antibody
    • Thyroid nuclear factor 1 antibody
    • Thyroid nuclear factor antibody
    • Thyroid specific enhancer binding protein antibody
    • Thyroid transcription factor 1 antibody
    • Tin man antibody
    • Tinman antibody
    • TITF 1 antibody
    • TITF1 antibody
    • TTF 1 antibody
    • TTF-1 antibody
    • TTF1 antibody
    see all

Images

  • Immunohistochemical analysisn of formalin fixed, paraffin embedded Human lung adenocarcinoma tissue labeling TTF1 with ab212886 at 1 µg/ml.

  • Immunohistochemical analysisn of formalin fixed, paraffin embedded Human thyroid tissue labeling TTF1 with ab212886 at 1 µg/ml.

References

ab212886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up