Anti-TTF1 antibody (ab204411)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-TTF1 antibody
See all TTF1 primary antibodies -
Description
Rabbit polyclonal to TTF1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TTF1 aa 397-495.
Sequence:VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACL ASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSA V
Database link: Q15361 -
Positive control
- Human testis tissue; RT-4 and U-251 cell lysates; MCF7 cells.
-
General notes
This product was previously labelled as Transcription termination factor 1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab204411 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/1000 - 1/2500. Predicted molecular weight: 103 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Use PFA/Triton X-100 Fixation/Permeabilization. |
Target
-
Function
Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation and silencing of rDNA transcription. Interaction with BAZ2A/TIP5 recovers DNA-binding activity. -
Sequence similarities
Contains 2 Myb-like domains. -
Domain
The N-terminal region (NRD) inhibits DNA-binding via its interaction with the C-terminal region. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Nucleus > nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 7270 Human
- Omim: 600777 Human
- SwissProt: Q15361 Human
- Unigene: 54780 Human
-
Alternative names
- RNA polymerase I termination factor antibody
- Transcription termination factor 1 antibody
- Transcription termination factor I antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTF1 antibody (ab204411)Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling TTF1 with ab204411 at 1/500 dilution.
-
Western blot - Anti-TTF1 antibody (ab204411)All lanes : Anti-TTF1 antibody (ab204411) at 1/1000 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 103 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-TTF1 antibody (ab204411)Immunofluorescent analysis of PFA/Triton X-100 fixed and permeabilized MCF7 cells labeling TTF1 with ab204411 at 4 µg/ml (green).
Protocols
Datasheets and documents
References
This product has been referenced in:
- Fang L et al. Resistance to epithelial growth factor receptor tyrosine kinase inhibitors in a patient with transformation from lung adenocarcinoma to small cell lung cancer: A case report. Oncol Lett 14:593-598 (2017). Read more (PubMed: 28693210) »
