Overview

  • Product name

  • Description

    Rabbit polyclonal to TTF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TTF1 aa 397-495.
    Sequence:

    VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACL ASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSA V


    Database link: Q15361

  • Positive control

    • Human testis tissue; RT-4 and U-251 cell lysates; MCF7 cells.
  • General notes

     This product was previously labelled as Transcription termination factor 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/1000 - 1/2500. Predicted molecular weight: 103 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation and silencing of rDNA transcription. Interaction with BAZ2A/TIP5 recovers DNA-binding activity.
  • Sequence similarities

    Contains 2 Myb-like domains.
  • Domain

    The N-terminal region (NRD) inhibits DNA-binding via its interaction with the C-terminal region.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • RNA polymerase I termination factor antibody
    • Transcription termination factor 1 antibody
    • Transcription termination factor I antibody
    • Transcription termination factor RNA polymerase I antibody
    • TTF 1 antibody
    • TTF-1 antibody
    • TTF-I antibody
    • Ttf1 antibody
    • TTF1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling TTF1 with ab204411 at 1/500 dilution.

  • All lanes : Anti-TTF1 antibody (ab204411) at 1/1000 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 103 kDa

  • Immunofluorescent analysis of PFA/Triton X-100 fixed and permeabilized MCF7 cells labeling TTF1 with ab204411 at 4 µg/ml (green).

References

This product has been referenced in:

  • Fang L  et al. Resistance to epithelial growth factor receptor tyrosine kinase inhibitors in a patient with transformation from lung adenocarcinoma to small cell lung cancer: A case report. Oncol Lett 14:593-598 (2017). Read more (PubMed: 28693210) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up