Overview

  • Product name

  • Description

    Rabbit polyclonal to TTI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TTI1 aa 692-858.
    Sequence:

    NQNSDYLVNGISLNLRHLALHPHTPKVLEVMLRNSDANLLPLVADVVQDV LATLDQFYDKRAASFVSVLHALMAALAQWFPDTGNLGHLQEQSLGEEGSH LNQRPAALEKSTTTAEDIEQFLLNYLKEKDVADGNVSDFDNEEEEQSVPP KVDENDTRPDVEPPLPL


    Database link: O43156

  • Positive control

    • IHC-P: Human heart and renal tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    TTI1 promotes assembly, stabilizes and maintains the activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals. TTI1 interacts with TELO2, MTOR, ATM, ATR, PRKDC, SMG1 and TRRAP.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • TTI1 antibody
    • KIAA0406 antibody
    • smg 10 antibody
    • smg 10 homolog nonsense mediated mRNA decay factor antibody
    • SMG10 antibody
    • Tel two interacting protein 1 antibody
    • Tel2 interacting protein 1 homolog (S. pombe) antibody
    • TEL2 interacting protein 1 homolog antibody
    • TELO2 interacting protein 1 antibody
    see all

Images

  • Paraffin-embedded human renal tissue stained for TTI1 using ab234871 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for TTI1 using ab234871 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling TTI1 (green) using ab234871 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up