Overview

  • Product name

    Anti-TTI2 antibody - C-terminal
    See all TTI2 primary antibodies
  • Description

    Rabbit polyclonal to TTI2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TTI2 aa 458-508 (C terminal). The exact sequence is proprietary. (NP_079391.2).
    Sequence:

    ATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVVNYIRKVQQVSEGAPYN


    Database link: Q6NXR4

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.
  • General notes

     This product was previously labelled as C8ORF41

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-TTI2 antibody - C-terminal (ab176698) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation. ab176698 at 1 µg/ml staining TTI2 in HeLa whole cell lysate immunoprecipitated using ab176698 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
    Lane 2: control IgG.

References

ab176698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up