Overview

  • Product name

    Anti-TTK/Mps1 antibody [3G7]
    See all TTK/Mps1 primary antibodies
  • Description

    Mouse monoclonal [3G7] to TTK/Mps1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human TTK/Mps1 aa 1-176. (AAH00633).
    Sequence:

    MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSG TVNQIMMMANNPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPP DKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCKKFAFVHISFA QFELSQGNVKKSKQLLQKAVERGAVP


    Database link: P33981

  • Positive control

    • Human testis tissue; HeLa and K562 cell lysates; Msp1-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab219068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 97 kDa.

Target

  • Function

    Phosphorylates proteins on serine, threonine, and tyrosine. Probably associated with cell proliferation. Essential for chromosome alignment by enhancing AURKB activity (via direct CDCA8 phosphorylation) at the centromere, and for the mitotic checkpoint.
  • Tissue specificity

    Present in rapidly proliferating cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • cancer/testis antigen 96 antibody
    • CT96 antibody
    • Dual specificity protein kinase TTK antibody
    • ECSTY kinase antibody
    • ESK antibody
    • FLJ38280 antibody
    • hMPS1 antibody
    • Monopolar Spindle 1 Like 1 antibody
    • MPH1 antibody
    • Mps 1 antibody
    • MPS1L1 antibody
    • Phosphotyrosine Picked Threonine Kinase antibody
    • Phosphotyrosine picked threonine-protein kinase antibody
    • PYT antibody
    • RP3-357D13.2 antibody
    • ttk antibody
    • TTK Protein Kinase antibody
    • TTK_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human testis tissue labeling TTK/Mps1 with ab219068 at 10 μg/ml.

  • All lanes : Anti-TTK/Mps1 antibody [3G7] (ab219068) at 1/500 dilution

    Lane 1 : TTK/Mps1-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Predicted band size: 97 kDa

  • Anti-TTK/Mps1 antibody [3G7] (ab219068) at 1/500 dilution + K562 cell lysate

    Predicted band size: 97 kDa

  • Anti-TTK/Mps1 antibody [3G7] (ab219068) at 1/500 dilution + HeLa cell lysate

    Predicted band size: 97 kDa

References

ab219068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up