Overview

  • Product name

  • Description

    Rabbit polyclonal to TTPA/TPP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to TTPA/TPP1 aa 204-253 (C terminal).
    Sequence:

    HAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSME


    Database link: NP_000361

  • Positive control

    • Jurkat cell lysate.
  • General notes

     This product was previously labelled as TTPA

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab123030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 - 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Binds alpha-tocopherol and enhances its transfer between separate membranes.
  • Involvement in disease

    Defects in TTPA are the cause of ataxia with isolated vitamin E deficiency (AVED) [MIM:277460]. AVED is an autosomal recessive disease characterized by spinocerebellar degeneration. It causes ataxia and peripheral neuropathy that resembles Friedreich ataxia. AVED patients have markedly reduced plasma levels of vitamin E.
  • Sequence similarities

    Contains 1 CRAL-TRIO domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-tocopherol transfer protein antibody
    • Alpha-TTP antibody
    • AlphaTTP antibody
    • ATTP antibody
    • AVED antibody
    • Tocopherol (alpha) transfer protein (ataxia (Friedreich-like) with vitamin E deficiency) antibody
    • TTP1 antibody
    • TTPA antibody
    • TTPA_HUMAN antibody
    see all

Images

  • Anti-TTPA/TPP1 antibody (ab123030) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    Goat anti-Rabbit IgG-HRP

    Predicted band size: 32 kDa



    Gel concentration: 12%.

References

ab123030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up