Anti-TTYH1 antibody (ab204046)
Key features and details
- Rabbit polyclonal to TTYH1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TTYH1 antibody -
Description
Rabbit polyclonal to TTYH1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey -
Immunogen
Recombinant fragment corresponding to Human TTYH1 aa 272-381.
Sequence:SDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRA LANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGNFHQLVALLHCR SLHKDYGAAL
Database link: Q9H313 -
Positive control
- IHC-P: Human cerebellum tissue. WB: Human cerebral cortex tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204046 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 49 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Probable chloride channel. May be involved in cell adhesion.
Isoform 3 may be a Ca(2+)-independent and swelling-activated chloride channel, possibly involved in regulation of cell volume. -
Tissue specificity
Expressed in brain, eye, ovary and testis, and at lower levels in muscle, placenta, liver and lung. -
Sequence similarities
Belongs to the tweety family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 767943 Cow
- Entrez Gene: 101866113 Cynomolgus monkey
- Entrez Gene: 57348 Human
- Entrez Gene: 57776 Mouse
- Entrez Gene: 292597 Rat
- Omim: 605784 Human
- SwissProt: Q2KJ98 Cow
- SwissProt: Q9MZZ8 Cynomolgus monkey
see all -
Alternative names
- hTTY1 antibody
- hTTYs antibody
- Protein tweety homolog 1 antibody
see all
Images
-
Anti-TTYH1 antibody (ab204046) at 0.4 µg/ml + Human cerebral cortex tissue lysate
Predicted band size: 49 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TTYH1 antibody (ab204046)
Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labeling TTYH1 in the neuropil with ab204046 at a 1/50 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Datasheets and documents
References (0)
ab204046 has not yet been referenced specifically in any publications.