Overview

  • Product name

  • Description

    Rabbit polyclonal to TUBD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human TUBD1 aa 170-220 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLLHENDAIHKICAKLMNI K


    Database link: Q9UJT1

  • Positive control

    • Mouse heart lysate.
  • General notes

     This product was previously labelled as Delta 1 Tubulin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 51 kDa.

Target

Images

  • Anti-TUBD1 antibody (ab214216) at 1/300 dilution + mouse heart lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/5000 dilution

    Developed using the ECL technique.

    Predicted band size: 51 kDa

References

This product has been referenced in:

  • Dunleavy JEM  et al. Katanin-like 2 (KATNAL2) functions in multiple aspects of haploid male germ cell development in the mouse. PLoS Genet 13:e1007078 (2017). Read more (PubMed: 29136647) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up