Overview

  • Product name

  • Description

    Rabbit polyclonal to TUBD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat TUBD1 aa 238-483 (N terminal). (Expressed in E. coli).
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFVFQPTHSEDSSFHY CRNPLVSGIVGPGLPHATNVCLVALYRRPMFLSTNGDLMEHLVPHPEFKM LGVRNIPQMSAESLAYSTFTWAGLLKHLRQMLISRAKMEEGIDWQVRPPL SGLPPIGKASAHKEPHFNTSLANLVILRGREVHSADVGGFRDAALYTSWL EPADAFSVWKTPRPFDKYEKSAALVSNSQLLVKPLDMVVGKAWNMFSSKA YIHQYTKFGMEEEDFLDSFTLLEQVVASYGS


    Database link: A0A0G2K6I6

  • Positive control

    • WB: Mouse testis and rat kidney tissues lysates. IHC-P: Stomach, kidney, testis and spleen tissues.
  • General notes

     This product was previously labelled as Delta 1 Tubulin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 54 kDa.

Target

  • Function

    In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.
  • Sequence similarities

    Belongs to the tubulin family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm. Nucleus. Associated with centrioles. Both cytoplasmic and nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • Delta tubulin antibody
    • Delta-tubulin antibody
    • FLJ12709 antibody
    • TBD_HUMAN antibody
    • TUBD antibody
    • TUBD1 antibody
    • Tubulin delta chain antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for TUBD1 using ab231141 at 20 ug/ml in immunohistochemical analysis. DAB stained.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for TUBD1 using ab231141 at 20 ug/ml in immunohistochemical analysis. DAB stained.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for TUBD1 using ab231141 at 20 ug/ml in immunohistochemical analysis. DAB stained.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for TUBD1 using ab231141 at 20 ug/ml in immunohistochemical analysis. DAB stained.

  • All lanes : Anti-TUBD1 antibody (ab231141) at 3 µg/ml

    Lane 1 : Rat kidney tissue lysate
    Lane 2 : Mouse testis tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab. at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 54 kDa

  • Anti-TUBD1 antibody (ab231141) at 3 µg/ml + Recombinant TUBD1 protein.

    Developed using the ECL technique.

    Predicted band size: 54 kDa

References

ab231141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up