Overview

  • Product name

  • Description

    Rabbit polyclonal to TUBD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TUBD1 aa 238-314.
    Sequence:

    VFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAY TTFTWAGLLKHLRQMLISNAKMEEGID


    Database link: Q9UJT1

  • Positive control

    • IHC-P: Human duodenum tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as Delta 1 Tubulin

     

Properties

Applications

Our Abpromise guarantee covers the use of ab246947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.
  • Sequence similarities

    Belongs to the tubulin family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm. Nucleus. Associated with centrioles. Both cytoplasmic and nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • Delta tubulin antibody
    • Delta-tubulin antibody
    • FLJ12709 antibody
    • TBD_HUMAN antibody
    • TUBD antibody
    • TUBD1 antibody
    • Tubulin delta chain antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling TUBD1 using ab246947 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human duodenum tissue stained for TUBD1 using ab246947 at 1/20 dilution in immunohistochemical analysis.

References

ab246947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up