Overview

  • Product name

    Anti-Tuberin antibody [7249]
    See all Tuberin primary antibodies
  • Description

    Mouse monoclonal [7249] to Tuberin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IPmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Tuberin aa 1-610. Folded protein domain.
    Sequence:

    MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSM ECGLNNRIRMIGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHA VLALLKAIVQGQGERLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNG RHITYLEEELADFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIARMVQ MICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVK ELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVG MALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYR KELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEF HGSQERYFELVERCADQRPESSLLNLISYRAQSIHPAKDGWIQNLQALME RFFRSESRGAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDK DHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDV AAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKH SYTLPIASSI


    Database link: P49815

  • Positive control

    • HEK293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab200477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

2 µg per IP.

Target

  • Function

    In complex with TSC1, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling. Stimulates weakly the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5 in vitro. Mutations in TSC2 lead to constitutive activation of RAP1A in tumors.
  • Tissue specificity

    Liver, brain, heart, lymphocytes, fibroblasts, biliary epithelium, pancreas, skeletal muscle, kidney, lung and placenta.
  • Involvement in disease

    Defects in TSC2 are the cause of tuberous sclerosis type 2 (TSC2) [MIM:613254]. TSC2 is an autosomal dominant multi-system disorder that affects especially the brain, kidneys, heart, and skin. It is characterized by hamartomas (benign overgrowths predominantly of a cell or tissue type that occurs normally in the organ) and hamartias (developmental abnormalities of tissue combination). Clinical symptoms can range from benign hypopigmented macules of the skin to profound mental retardation with intractable seizures to premature death from a variety of disease-associated causes.
    Defects in TSC2 are a cause of lymphangioleiomyomatosis (LAM) [MIM:606690]. LAM is a progressive and often fatal lung disease characterized by a diffuse proliferation of abnormal smooth muscle cells in the lungs. It affects almost exclusively young women and can occur as an isolated disorder or in association with tuberous sclerosis complex.
  • Sequence similarities

    Contains 1 Rap-GAP domain.
  • Post-translational
    modifications

    Phosphorylation at Ser-1387, Ser-1418 or Ser-1420 does not affect interaction with TSC1.
    Phosphorylation at Ser-939 and Thr-1462 by PKB/AKT1 is induced by growth factor stimulation.
  • Cellular localization

    Cytoplasm. Membrane. At steady state found in association with membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ43106 antibody
    • LAM antibody
    • OTTHUMP00000158940 antibody
    • OTTHUMP00000198394 antibody
    • OTTHUMP00000198395 antibody
    • PPP1R160 antibody
    • Protein phosphatase 1, regulatory subunit 160 antibody
    • TSC complex subunit 2 antibody
    • tsc2 antibody
    • TSC2_HUMAN antibody
    • TSC4 antibody
    • TSC4 gene, formerly antibody
    • TSC4, formerly antibody
    • Tuberin antibody
    • Tuberous sclerosis 2 antibody
    • Tuberous sclerosis 2 protein antibody
    • Tuberous sclerosis 2 protein homolog antibody
    see all

References

ab200477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up