Anti-TUSC2/FUS1 antibody (ab246970)
Key features and details
- Rabbit polyclonal to TUSC2/FUS1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TUSC2/FUS1 antibody
See all TUSC2/FUS1 primary antibodies -
Description
Rabbit polyclonal to TUSC2/FUS1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human TUSC2/FUS1 aa 4-106.
Sequence:SGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFY DEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDF PVI
Database link: O75896 -
Positive control
- WB: HEK-293T overexpressing TUSC2/FUS1 with a C-terminal myc-DDK tag, whole cell lysate. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as TUSC2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246970 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 12 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. -
Tissue specificity
Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta. -
Sequence similarities
Belongs to the TUSC2 family. -
Post-translational
modificationsMyristoylation is required for tumor suppressor activity. - Information by UniProt
-
Database links
- Entrez Gene: 11334 Human
- Entrez Gene: 80385 Mouse
- Omim: 607052 Human
- SwissProt: O75896 Human
- SwissProt: Q9WVF8 Mouse
- Unigene: 517981 Human
- Unigene: 21739 Mouse
-
Alternative names
- C3orf11 antibody
- Fus-1 protein antibody
- FUS1 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TUSC2/FUS1 (green) using ab246970 at 4 μg/ml in ICC/IF.
-
All lanes : Anti-TUSC2/FUS1 antibody (ab246970) at 0.4 µg/ml
Lane 1 : Vextor only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : HEK-293T overexpressing TUSC2/FUS1 with a C-terminal myc-DDK tag, whole cell lysate.
Predicted band size: 12 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246970 has not yet been referenced specifically in any publications.