Overview

  • Product name

    Anti-TWF1/Twinfilin-1 antibody
    See all TWF1/Twinfilin-1 primary antibodies
  • Description

    Rabbit polyclonal to TWF1/Twinfilin-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human TWF1/Twinfilin-1 aa 1-252. Expressed in E.coli. N-terminal tag.
    Sequence:

    MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD KDYDSFVLPLLEDKQPCYILFRLDSQNAQGYEWIFIAWSPDHSHVRQKML YAATRATLKKEFGGGHIKDEVFGTVKEDVSLHGYKKYLLSQSSPAPLTAA EEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNY VQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYL ES


    Database link: Q12792-1

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human TWF1/Twinfilin-1 protein and pig mammary gland tissue lysate.
  • General notes

     This product was previously labelled as TWF1

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. Seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.
  • Tissue specificity

    Expressed at high levels in the colon, testis, ovary, prostate and lung. Expressed at lower levels in the brain, bladder and heart. Not detected in liver.
  • Sequence similarities

    Belongs to the actin-binding proteins ADF family. Twinfilin subfamily.
    Contains 2 ADF-H domains.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Diffuse cytoplasmic localization with perinuclear and G-actin-rich cortical actin structures sublocalization. Also found at membrane ruffles and cell-cell contacts.
  • Information by UniProt
  • Database links

  • Alternative names

    • A6 antibody
    • A6 protein tyrosine kinase antibody
    • MGC105817 antibody
    • MGC23788 antibody
    • MGC41876 antibody
    • Protein A6 antibody
    • Protein tyrosine kinase 9 antibody
    • PTK9 antibody
    • PTK9 protein tyrosine kinase 9 antibody
    • TWF 1 antibody
    • twf1 antibody
    • TWF1_HUMAN antibody
    • Twinfilin 1 antibody
    • Twinfilin actin binding protein, homolog 1 antibody
    • Twinfilin antibody
    • Twinfilin, actin-binding protein, homolog 1 (Drosophila) antibody
    • Twinfilin, Drosophila, homolog of, 1 antibody
    • Twinfilin-1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for TWF1/Twinfilin-1 using ab233129 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-TWF1/Twinfilin-1 antibody (ab233129) at 3 µg/ml + Pig mammary gland tissue lysate

    Secondary
    HRP-conjugated goat anti-rabbit IgG (polyclonal) at 0.2 µg/ml
  • Anti-TWF1/Twinfilin-1 antibody (ab233129) at 2 µg/ml + Recombinant human TWF1/Twinfilin-1 protein

References

ab233129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up