Anti-TWSG1/TSG antibody (ab244341)
Key features and details
- Rabbit polyclonal to TWSG1/TSG
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TWSG1/TSG antibody
See all TWSG1/TSG primary antibodies -
Description
Rabbit polyclonal to TWSG1/TSG -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Chicken, Orangutan -
Immunogen
Recombinant fragment corresponding to Human TWSG1/TSG aa 68-217.
Sequence:DECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWN IVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMC TVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVK
Database link: Q9GZX9 -
Positive control
- ICC/IF: U-251 MG cells. IHC-P: Human stomach tissue.
-
General notes
This product was previously labelled as TWSG1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244341 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in dorsoventral axis formation. Seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. In addition to the anti-BMP function, also has pro-BMP activity, partly mediated by cleavage and degradation of CHRD, which releases BMPs from ternary complexes. May be an important modulator of BMP-regulated cartilage development and chondrocyte differentiation. May play a role in thymocyte development. -
Sequence similarities
Belongs to the twisted gastrulation protein family. -
Developmental stage
Expressed in brain throughout development. -
Domain
The N-terminal domain is sufficient to interact with BMP4. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 57045 Human
- Entrez Gene: 65960 Mouse
- Omim: 605049 Human
- SwissProt: Q9GZX9 Human
- SwissProt: Q9EP52 Mouse
- Unigene: 514685 Human
- Unigene: 10153 Mouse
-
Alternative names
- PSEC0250 antibody
- twisted gastrulation homolog 1 (Drosophila) antibody
- TSG antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TWSG1/TSG antibody (ab244341)
Formalin-fixed, paraffin-embedded human stomach tissue stained for TWSG1/TSG with ab244341 at a 1/50 dilution in immunohistochemical analysis.
-
PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling TWSG1/TSG using ab244341 at 4 µg/ml (green) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244341 has not yet been referenced specifically in any publications.