Anti-TXNDC/TMX antibody (ab174660)
Key features and details
- Rabbit polyclonal to TXNDC/TMX
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TXNDC/TMX antibody
See all TXNDC/TMX primary antibodies -
Description
Rabbit polyclonal to TXNDC/TMX -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Rhesus monkey, Gorilla -
Immunogen
Synthetic peptide within Human TXNDC/TMX aa 230-280. The exact sequence is proprietary. NP_110382.3
Sequence:QPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDK S
Database link: Q9H3N1 -
Positive control
- Jurkat, 293T and HeLa whole cell lysate (ab150035).
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab174660 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 32 kDa.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 32 kDa. |
Target
-
Function
May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. -
Tissue specificity
Ubiquitous. Highly expressed in kidney, liver, placenta and lung. -
Sequence similarities
Contains 1 thioredoxin domain. -
Cellular localization
Membrane. Endoplasmic reticulum membrane. Predominantly found in the endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 81542 Human
- Omim: 610527 Human
- SwissProt: Q9H3N1 Human
- Unigene: 125221 Human
-
Alternative names
- PDIA11 antibody
- Protein disulfide isomerase family A, member 11 antibody
- Thioredoxin domain containing 1 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab174660 has not yet been referenced specifically in any publications.