Overview

  • Product name

  • Description

    Rabbit polyclonal to TXNIP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Mouse TXNIP aa 30-381. (N-terminal His-tag and GST-tag; Expressed in E.coli)
    Sequence:

    RVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLE EQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAF LDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRV SVSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTK VFTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLLI YVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTP EAPPCYMDIIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPPTY TE


    Database link: Q8BG60

  • Positive control

    • WB: Recombinant mouse TXNIP protein; Mouse intestine lysate. IHC-P: Mouse brain, testis, skeletal muscle, uterus, ovary and colon tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells.
  • Sequence similarities

    Belongs to the arrestin family.
  • Post-translational
    modifications

    Ubiquitinated; undergoes polyubiquitination catalyzed by ITCH resulting in proteasomal degradation.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EST01027 antibody
    • HHCPA78 antibody
    • THIF antibody
    • Thioredoxin binding protein 2 antibody
    • Thioredoxin interacting protein antibody
    • Thioredoxin-binding protein 2 antibody
    • Thioredoxin-interacting protein antibody
    • TXNIP antibody
    • TXNIP_HUMAN antibody
    • Upregulated by 1,25 dihydroxyvitamin D 3 antibody
    • VDUP1 antibody
    • Vitamin D3 up-regulated protein 1 antibody
    see all

Images

  • Paraffin-embedded mouse colon tissue stained for TXNIP using ab231966 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse ovary tissue stained for TXNIP using ab231966 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse uterus tissue stained for TXNIP using ab231966 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse skeletal muscle tissue stained for TXNIP using ab231966 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for TXNIP using ab231966 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse brain tissue stained for TXNIP using ab231966 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TXNIP antibody (ab231966) at 1 µg/ml + Mouse intestine lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 44 kDa

  • Anti-TXNIP antibody (ab231966) at 1 µg/ml + Recombinant mouse TXNIP protein

    Predicted band size: 44 kDa

References

This product has been referenced in:

  • Zhang C  et al. The protective effects of orexin a against high glucose-induced activation of NLRP3 inflammasome in human vascular endothelial cells. Arch Biochem Biophys 672:108052 (2019). Read more (PubMed: 31351069) »
  • Yang C  et al. Role of TXNIP/NLRP3 in sepsis-induced myocardial dysfunction. Int J Mol Med 44:417-426 (2019). Read more (PubMed: 31173172) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up