Overview

  • Product name

  • Description

    Rabbit polyclonal to TXNL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human TXNL1 aa 2-289.
    Sequence:

    VGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKY PQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEE KIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNESDEHGFDNCLR KDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLP RSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSN QGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH


    Database link: O43396

  • Positive control

    • IHC-P: Human thyroid and colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human thyroid tissue stained for TXNL1 using ab238163 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for TXNL1 using ab238163 at 1/100 dilution in immunohistochemical analysis.

References

ab238163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up