Overview

  • Product name

  • Description

    Rabbit polyclonal to TXNL4B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human TXNL4B aa 1-149.
    Sequence:

    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSS DLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHT KFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI


    Database link: Q9NX01

  • Positive control

    • IHC-P: Human tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.
  • Sequence similarities

    Belongs to the DIM1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI595343 antibody
    • D530025J19Rik antibody
    • Dim1 like protein antibody
    • Dim1-like protein antibody
    • DIM2 antibody
    • DLP antibody
    • FLJ20511 antibody
    • MGC109322 antibody
    • RGD1305127 antibody
    • Thioredoxin like 4B antibody
    • Thioredoxin like protein 4B antibody
    • Thioredoxin-like protein 4B antibody
    • TXN4B_HUMAN antibody
    • Txnl4b antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for TXNL4B using ab230222 at 1/100 dilution in immunohistochemical analysis.

References

ab230222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up