Anti-TYK2 antibody (ab223733)
Key features and details
- Rabbit polyclonal to TYK2
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TYK2 antibody
See all TYK2 primary antibodies -
Description
Rabbit polyclonal to TYK2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TYK2 aa 240-387.
Sequence:RFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGE PCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGS SGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWAYFCDFRDITHVV
Database link: P29597 -
Positive control
- WB: PC-3 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human lung, skin, prostate and Fallopian tube tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab223733 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 134 kDa. | |
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain. -
Tissue specificity
Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines. -
Involvement in disease
Defects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
Contains 1 FERM domain.
Contains 1 protein kinase domain.
Contains 1 SH2 domain. -
Domain
The FERM domain mediates interaction with JAKMIP1. - Information by UniProt
-
Database links
- Entrez Gene: 7297 Human
- Omim: 176941 Human
- SwissProt: P29597 Human
- Unigene: 75516 Human
-
Alternative names
- JTK 1 antibody
- JTK1 antibody
- Non receptor tyrosine protein kinase 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
Immunohistochemical analysis of Formalin fixed Paraffin-embedded human lung tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Anti-TYK2 antibody (ab223733) at 1/100 dilution + PC-3 (human prostate adenocarcinoma cell line) cell lysate
Predicted band size: 134 kDa -
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TYK2 (green) using ab223733 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
Immunohistochemical analysis of Formalin fixed Paraffin-embedded human skin tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
Immunohistochemical analysis of Formalin fixed Paraffin-embedded human Fallopian tube tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
Immunohistochemical analysis of Formalin fixed Paraffin-embedded human prostate tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
References (1)
ab223733 has been referenced in 1 publication.
- Yin D et al. Pro-Angiogenic Role of LncRNA HULC in Microvascular Endothelial Cells via Sequestrating miR-124. Cell Physiol Biochem 50:2188-2202 (2018). PubMed: 30415256