For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    tyk2-antibody-ab223733.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Tyrosine Kinases Other
Share by email

Anti-TYK2 antibody (ab223733)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
  • Western blot - Anti-TYK2 antibody (ab223733)
  • Immunocytochemistry/ Immunofluorescence - Anti-TYK2 antibody (ab223733)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)

Key features and details

  • Rabbit polyclonal to TYK2
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant human TYK2 protein (ab125539)
Primary
Product image
Anti-TYK2 (phospho Y292) antibody (ab138394)
Primary
Product image
Anti-JAK1 (phospho Y1022 + Y1023) antibody [EPR1899(2)] - BSA and Azide free (ab203784)

View more associated products

Overview

  • Product name

    Anti-TYK2 antibody
    See all TYK2 primary antibodies
  • Description

    Rabbit polyclonal to TYK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TYK2 aa 240-387.
    Sequence:

    RFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGE PCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGS SGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWAYFCDFRDITHVV


    Database link: P29597
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: PC-3 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human lung, skin, prostate and Fallopian tube tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Tyrosine Kinases
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant human TYK2 protein (ab125539)

Applications

Our Abpromise guarantee covers the use of ab223733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 134 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
  • Tissue specificity

    Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
  • Involvement in disease

    Defects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain

    The FERM domain mediates interaction with JAKMIP1.
  • Target information above from: UniProt accession P29597 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7297 Human
    • Omim: 176941 Human
    • SwissProt: P29597 Human
    • Unigene: 75516 Human
    • Alternative names

      • JTK 1 antibody
      • JTK1 antibody
      • Non receptor tyrosine protein kinase 2 antibody
      • Non receptor tyrosine protein kinase TYK2 antibody
      • Non-receptor tyrosine-protein kinase TYK2 antibody
      • OTTHUMP00000232745 antibody
      • OTTHUMP00000232746 antibody
      • OTTHUMP00000232748 antibody
      • Protein Tyrosine Kinase 2 antibody
      • TYK 2 antibody
      • Tyk2 antibody
      • TYK2_HUMAN antibody
      • Tyrosine kinase 2 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)

      Immunohistochemical analysis of Formalin fixed Paraffin-embedded human lung tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Western blot - Anti-TYK2 antibody (ab223733)
      Western blot - Anti-TYK2 antibody (ab223733)
      Anti-TYK2 antibody (ab223733) at 1/100 dilution + PC-3 (human prostate adenocarcinoma cell line) cell lysate

      Predicted band size: 134 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-TYK2 antibody (ab223733)
      Immunocytochemistry/ Immunofluorescence - Anti-TYK2 antibody (ab223733)

      PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TYK2 (green) using ab223733 at 4 µg/ml in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)

      Immunohistochemical analysis of Formalin fixed Paraffin-embedded human skin tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)

      Immunohistochemical analysis of Formalin fixed Paraffin-embedded human Fallopian tube tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)

      Immunohistochemical analysis of Formalin fixed Paraffin-embedded human prostate tissue labeling TYK2 with ab223733 at 1/20 dilution. Antigen retrieval was heat mediated with citrate buffer pH 6 before commencing with IHC staining protocol.

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab223733? Please let us know so that we can cite the reference in this datasheet.

    ab223733 has been referenced in 1 publication.

    • Yin D  et al. Pro-Angiogenic Role of LncRNA HULC in Microvascular Endothelial Cells via Sequestrating miR-124. Cell Physiol Biochem 50:2188-2202 (2018). PubMed: 30415256

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab223733.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.