Anti-TYK2 antibody (ab223733)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-TYK2 antibody
See all TYK2 primary antibodies -
DescriptionRabbit polyclonal to TYK2
-
Host speciesRabbit
-
Tested applicationsSuitable for: WB, IHC-P, ICC/IFmore details
-
Species reactivityReacts with: Human
-
Immunogen
Recombinant fragment corresponding to Human TYK2 aa 240-387.
Sequence:RFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGE PCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGS SGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWAYFCDFRDITHVV
Database link: P29597 -
Positive control
- WB: PC-3 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human colon tissue.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferpH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab223733 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 134 kDa. | |
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
FunctionProbably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
-
Tissue specificityObserved in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
-
Involvement in diseaseDefects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
-
Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
Contains 1 FERM domain.
Contains 1 protein kinase domain.
Contains 1 SH2 domain. -
DomainThe FERM domain mediates interaction with JAKMIP1.
- Information by UniProt
-
Database links
- Entrez Gene: 7297 Human
- Omim: 176941 Human
- SwissProt: P29597 Human
- Unigene: 75516 Human
-
Alternative names
- JTK 1 antibody
- JTK1 antibody
- Non receptor tyrosine protein kinase 2 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-TYK2 antibody (ab223733)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TYK2 (green) using ab223733 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYK2 antibody (ab223733)Paraffin-embedded human colon tissue stained for TYK2 using ab223733 at 1/20 dilution in immunohistochemical analysis.
-
Western blot - Anti-TYK2 antibody (ab223733)Anti-TYK2 antibody (ab223733) at 1/100 dilution + PC-3 (human prostate adenocarcinoma cell line) cell lysate
Predicted band size: 134 kDa
Datasheets and documents
Protocols
References
ab223733 has not yet been referenced specifically in any publications.
