Overview

  • Product name
  • Description
    Rabbit polyclonal to TYK2
  • Host species
    Rabbit
  • Specificity
    This antibody detects endogenous levels of TYK2 protein around Tyrosine 1054.
  • Tested applications
    Suitable for: ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic non-phosphopeptide derived from human TYK2 around the phosphorylation site of Tyrosine 1054.

  • Positive control
    • Human breast carcinoma tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 0.87% Sodium chloride
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab39550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
  • Tissue specificity
    Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
  • Involvement in disease
    Defects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain
    The FERM domain mediates interaction with JAKMIP1.
  • Information by UniProt
  • Database links
  • Alternative names
    • JTK 1 antibody
    • JTK1 antibody
    • Non receptor tyrosine protein kinase 2 antibody
    • Non receptor tyrosine protein kinase TYK2 antibody
    • Non-receptor tyrosine-protein kinase TYK2 antibody
    • OTTHUMP00000232745 antibody
    • OTTHUMP00000232746 antibody
    • OTTHUMP00000232748 antibody
    • Protein Tyrosine Kinase 2 antibody
    • TYK 2 antibody
    • Tyk2 antibody
    • TYK2_HUMAN antibody
    • Tyrosine kinase 2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human breast carcinoma, using ab39550 (10-20µg/ml). Left: Untreated; Right: Treated with synthesized peptide.

References

This product has been referenced in:
  • Hirbe AC  et al. Clinical genomic profiling identifies TYK2 mutation and overexpression in patients with neurofibromatosis type 1-associated malignant peripheral nerve sheath tumors. Cancer 123:1194-1201 (2017). Read more (PubMed: 27875628) »
See 1 Publication for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Abreviews
Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Salmo salar Cell lysate - whole cell (cell lines transfected with GFP-TYK2)
Loading amount
100000 cells
Specification
cell lines transfected with GFP-TYK2
Gel Running Conditions
Reduced Denaturing (4 - 12 %)
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 03 2012

Answer

The codes will be activated only once we receive your Abreviews. As explained in a previous email, the testing offer works as follow : 1. Purchase the antibody to be tested. 2. Test the antibodies 3. Let us know the results, positive or negative, using our Abreview system. To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews . 4. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any priamry antibody ordered and the discount code is valid for 4 months after issue. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount . I hope this is helpful.  

Read More

Answer

The TYK2 antibody has not been tested yet in other application but IHC-P and ELISA. If it was not suitable for a tested application this information would appear on the datasheet. The monoclonal STAT1 antibody has the advantage to have no variability in the way it binds to the target. Since the homology is not 100%, it may be a straight yes or no answer. It would be much more difficult to characterise the suitability of a polyclonal for the salmon species due to its high variability in the binding of the target. DISCOUNT CODE for ab14743 : *********** DISCOUNT CODE for ab39550 : *********** Expiration date for both codes : DD MM YYYY We are very pleased to hear you would like to accept our offer and test ab14743 and ab39550 in Salmon. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for salmon samples and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Question

As I saw in you homepage, your peptide antibodies are based on C-terminal. Here is C-terminal sequence for our construct. we appreciate your offer/help We are also interested in antibodies for salmon STAT1. I add the sequence for that as well, in case you had a saggestion for us.  401 TITGANVSII KQDNFSMEVQ MNSSLEALSF VSLLDGYFRL TADAHHYLCH       451 EVAPPRVVLS ATNGLHGPMN DDFVLQRLRK EAVEEGAFLV RWSVLDYHRI       501 ILAVLNKSQN GQAAIHKQFR ILHSGSVFAL EGWDREFSSV KELTDSLKAF       551 VLKSGTDNFT VKKCCLPRPA ELSNLLVMRQ GVDQCVQPDS VALCLTQLKF       601 HQIKDKEITQ EQHLGRGTRT NIYSGRLLVW GGAEEDEEDK WNNNLTDRKE       651 IRVVLKILDQ SHKDIALAFF ETASLMSQVS HSHLVFVHGV SVKGSENIMV       701 EEFVEFGPLD VFLRRERALV TPQWKFTVAK QLASALSYLE TKQLVHGNVC       751 GKNILVARRG LEEGTFPFVK LSDPGIALNV LSREERVERI PWIAPECVPS       801 SAPFGRAADQ WSFGATLLEI CNNGDLPMSG STLTEKERFY ETRSRLTEPS       851 SQELASFISM CLTYEPRERP SFRTVLRELT ELQLKNPDIS PLESLPDADP       901 NVFLKRYLKK IRDLGEGHFG KVMLYVYDPA NDGTGDYVAV KALKHEGGSH       951 LHEGWMKEIE ILKSLYHSNI VKYKGCCSEL GGQTVQLIME FLPLGSLREY      1001 LVKHRLGVAH SLLFAQQICQ GMDYLHSKRY IHRDLAARNV LVENEHLVKI      1051 GDFGLTKYIP EGDVYYRVRE DGDSPVYWYA IECLKESKFS FSSDIWSFGV      1101 TLYEVLTHGD HRQSPPVKFT QMMGNVHGQM TVMVLVKLLE KHNRLPCPRD      1151 CPSEVHMLMQ HCWDFDPARR PSFKSLIESI GAIRKTYERQ PNMRLAQISQ      1201 *DPYFFTGQL ALLLYTSALC YINQL*SLHR TLHHSALCLS EGVDKGEFCR      1251 YPSHWRPLEH ASRGPNSPYS ESYYNSLAVV LQRRDWENPG VTQLNRLAAH      1301 PPFASWRNSE X      

Read More
Answer

Thank you for providing this information. For the detection of TYK2, I selected the following antibodies : - ab39550 : non-phospho peptide around Tyr 1054. 79% when comparing the region aa 1045-1064 (which is not the exact immunogen sequence, only the region) - ab54493 that recognizes TYK2 phosphorylated at Tyr1054/1055. It does not recognize non-phosphorylated TYK2. 79% when comparing the region aa 1045-1064 (which is not the exact immunogen sequence, only the region) - ab108064 78% : ab108064 HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP salmon     HRDLAARNVLVENEHLVKIGDFGLTKYIPEGDVYYRVREDGDSPVYWYAI               **********::*::*********:* :***. ************:***   For the detection of STAT1, I fselected the followinf antibody : - ab14743 73%homology with the Salmon STAT1 : ab14743 QLDSKFLEQVHQLYD STAT1A  LLESKYLEQVDQLYD              *:**:****.****   To our knowledge, the antibodies listed above have not been tested in Salmon samples. Therefore, I can offer a discount off a future purchase if you buy one of the anti-TYK2 and/or ab14743 now, test it in Salmon and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test one of the anti-TYK2 and/or ab14743 in Salmon. I will then send a discount code. This code must be issued before purchasing the antibodies so please wait for my reply before ordering. 2. Purchase one of the anti-TYK2 and/or ab14743 either by phone, fax, or online (www.abcam.com). 3. Test it in Salmon. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if the tested antibody turns out to be unsuitable for Salmon, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.    

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up