Anti-TYRO3 antibody (ab217802)
Key features and details
- Rabbit polyclonal to TYRO3
- Suitable for: IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-TYRO3 antibody
See all TYRO3 primary antibodies -
Description
Rabbit polyclonal to TYRO3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Human -
Immunogen
Synthetic peptide within Human TYRO3 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:LASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKD G
Database link: Q06418 -
Positive control
- Rat brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab217802 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. |
Target
-
Function
May be involved in cell adhesion processes, particularly in the central nervous system. In case of filovirus infection, seems to function as a cell entry factor. -
Tissue specificity
Abundant in the brain and lower levels in other tissues. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. AXL/UFO subfamily.
Contains 2 fibronectin type-III domains.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 protein kinase domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7301 Human
- Entrez Gene: 22174 Mouse
- Entrez Gene: 25232 Rat
- Omim: 600341 Human
- SwissProt: Q06418 Human
- SwissProt: P55144 Mouse
- SwissProt: P55146 Rat
- Unigene: 381282 Human
see all -
Alternative names
- Brt antibody
- BYK antibody
- DTK antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TYRO3 antibody (ab217802)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling TYRO3 with ab217802 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab217802 has not yet been referenced specifically in any publications.