Overview

  • Product name

    Anti-UACA/Nucling antibody
    See all UACA/Nucling primary antibodies
  • Description

    Mouse polyclonal to UACA/Nucling
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human UACA/Nucling aa 1-1416.
    Sequence:

    MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKV TSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIHGVDITTSDTA GRNALHLAAKYGHALCLQKLLQYNCPTEHADLQGRTALHDAAMADCPSSI QLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADVNSRDKQN RTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILT LLKTASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLE IENEDLKERLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKS LLAAKEKQHEESLRTIEALKNRFKYFESDHLGSGSHFSNRKEDMLLKQGQ MYMADSQCTSPGIPAHMQSRSMLRPLELSLPSQTSYSENEILKKELEAMR TFCESAKQDRLKLQNELAHKVAECKALALECERVKEDSDEQIKQLEDALK DVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTEELKDQLKDLK VKYEGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSMCEM EREKKGRKVTEMEGQAKELSAKLALSIPAEKFENMKSSLSNEVNEKAKKL VEMEREHEKSLSEIRQLKRELENVKAKLAQHVKPEEHEQVKSRLEQKSGE LGKKITELTLKNQTLQKEIEKVYLDNKLLKEQAHNLTIEMKNHYVPLKVS EDMKKSHDAIIDDLNRKLLDVTQKYTEKKLEMEKLLLENDSLSKDVSRLE TVFVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEKIHALTSENTN LKKMMSNQYVPVKTHEEVKMTLNDTLAKTNRELLDVKKKFEDINQEFVKI KDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEIL ANYRKGQEEIVTLHAEIKAQKKELDTIQECIKVKYAPIVSFEECERKFKA TEKELKDQLSEQTQKYSVSEEEVKKNKQENDKLKKEIFTLQKDLRDKTVL IEKSHEMERALSRKTDELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEI LAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVT KLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEE VSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANL NRKYEEVCEEVLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTI TELQRRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYTSGNPTK RQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDV QEALLQIIQMRQGLVC


    Database link: NP_060473.2

  • Positive control

    • UACA/Nucling transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab169684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 163 kDa.

Target

  • Function

    Regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. Promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. Regulates the redistribution of APAF1 into the nucleus after proapoptotic stress. Down-regulates the expression of LGALS3 by inhibiting NFKB1.
    Modulates isoactin dynamics to regulate the morphological alterations required for cell growth and motility. Interaction with ARF6 may modulate cell shape and motility after injury.
  • Tissue specificity

    Highly expressed in skeletal muscle, heart, kidney and pancreas. Expressed in choroid, retina and epidermal melanocytes. Expressed in eye muscles and thyroid follicular cells.
  • Sequence similarities

    Contains 6 ANK repeats.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > cytoskeleton. Expressed diffusely in cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10128 antibody
    • KIAA1561 antibody
    • MGC141967 antibody
    • MGC141969 antibody
    • Nuclear membrane binding protein antibody
    • NUCLING antibody
    • UACA antibody
    • UACA_HUMAN antibody
    • Uveal autoantigen with coiled coil domains and ankyrin repeats antibody
    • Uveal autoantigen with coiled-coil domains and ankyrin repeats antibody
    see all

Images

  • All lanes : Anti-UACA/Nucling antibody (ab169684) at 1 µg/ml

    Lane 1 : UACA/Nucling transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 163 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up