Overview

  • Product name

    Anti-UACA/Nucling antibody
    See all UACA/Nucling primary antibodies
  • Description

    Rabbit polyclonal to UACA/Nucling
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Cow, Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human UACA/Nucling aa 29-209. N-terminal tags. (Expressed in E.coli).
    Sequence:

    ADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSK GNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTE HADLQGRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMS RPTICQLLIDRGADVNSRDKQNRTALMLGCE


    Database link: Q9BZF9

  • Positive control

    • WB: HeLa whole cell lysate (ab150035); Cow pancreas lysate; Recombinant human UACA/Nucling protein. IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 163 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. Promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. Regulates the redistribution of APAF1 into the nucleus after proapoptotic stress. Down-regulates the expression of LGALS3 by inhibiting NFKB1.
    Modulates isoactin dynamics to regulate the morphological alterations required for cell growth and motility. Interaction with ARF6 may modulate cell shape and motility after injury.
  • Tissue specificity

    Highly expressed in skeletal muscle, heart, kidney and pancreas. Expressed in choroid, retina and epidermal melanocytes. Expressed in eye muscles and thyroid follicular cells.
  • Sequence similarities

    Contains 6 ANK repeats.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > cytoskeleton. Expressed diffusely in cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10128 antibody
    • KIAA1561 antibody
    • MGC141967 antibody
    • MGC141969 antibody
    • Nuclear membrane binding protein antibody
    • NUCLING antibody
    • UACA antibody
    • UACA_HUMAN antibody
    • Uveal autoantigen with coiled coil domains and ankyrin repeats antibody
    • Uveal autoantigen with coiled-coil domains and ankyrin repeats antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for UACA/Nucling using ab233432 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-UACA/Nucling antibody (ab233432) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Cow pancreas tissue

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 163 kDa

  • Anti-UACA/Nucling antibody (ab233432) at 2 µg/ml + Recombinant human UACA/Nucling protein

    Predicted band size: 163 kDa

References

ab233432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up