Overview

  • Product name

    Anti-UACA/Nucling antibody
    See all UACA/Nucling primary antibodies
  • Description

    Rabbit polyclonal to UACA/Nucling
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human UACA/Nucling aa 1075-1125.
    Sequence:

    LSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSL N


    Database link: NP_060473.2

  • Positive control

    • HeLa and 293T whole cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab99323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 162 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function

    Regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. Promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. Regulates the redistribution of APAF1 into the nucleus after proapoptotic stress. Down-regulates the expression of LGALS3 by inhibiting NFKB1.
    Modulates isoactin dynamics to regulate the morphological alterations required for cell growth and motility. Interaction with ARF6 may modulate cell shape and motility after injury.
  • Tissue specificity

    Highly expressed in skeletal muscle, heart, kidney and pancreas. Expressed in choroid, retina and epidermal melanocytes. Expressed in eye muscles and thyroid follicular cells.
  • Sequence similarities

    Contains 6 ANK repeats.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm > cytoskeleton. Expressed diffusely in cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10128 antibody
    • KIAA1561 antibody
    • MGC141967 antibody
    • MGC141969 antibody
    • Nuclear membrane binding protein antibody
    • NUCLING antibody
    • UACA antibody
    • UACA_HUMAN antibody
    • Uveal autoantigen with coiled coil domains and ankyrin repeats antibody
    • Uveal autoantigen with coiled-coil domains and ankyrin repeats antibody
    see all

Images

  • All lanes : Anti-UACA/Nucling antibody (ab99323) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 162 kDa


    Exposure time: 10 seconds
  • Detection of UACA/Nucling in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded), using ab99323 at 3 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 3 seconds.

References

ab99323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up