Anti-UBA3 antibody (ab247153)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-UBA3 antibody
See all UBA3 primary antibodies -
Description
Rabbit polyclonal to UBA3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBA3 aa 141-226.
Sequence:VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVL DPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE
Database link: Q8TBC4 -
Positive control
- IHC-P: Human skin tissue. ICC/IF: SiHa cells. WB: RT4 and U-251 MG whole cell lysate.
-
General notes
This product was previously labelled as UBE1C
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab247153 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression. -
Tissue specificity
Ubiquitously expressed. -
Pathway
Protein modification; protein neddylation. -
Sequence similarities
Belongs to the ubiquitin-activating E1 family. UBA3 subfamily. - Information by UniProt
-
Database links
- Entrez Gene: 9039 Human
- Omim: 603172 Human
- SwissProt: Q8TBC4 Human
- Unigene: 154320 Human
-
Alternative names
- DKFZp566J164 antibody
- EC 6.3.2. antibody
- hUba3 antibody
see all
Images
-
Western blot - Anti-UBA3 antibody (ab247153)All lanes : Anti-UBA3 antibody (ab247153) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (human brain glioma cell line) whole cell lysate -
Immunocytochemistry/ Immunofluorescence - Anti-UBA3 antibody (ab247153)PFA-fixed, Triton X-100 permeabilized SiHA cells stained for UBA3 (green) using ab247153 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBA3 antibody (ab247153)Paraffin-embedded human pancreas tissue stained for UBA3 using ab247153 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBA3 antibody (ab247153)Paraffin-embedded human skin tissue stained for UBA3 using ab247153 at 1/500 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab247153 has not yet been referenced specifically in any publications.
