Overview

  • Product name
  • Description
    Rabbit polyclonal to UBA5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human UBA5 aa 325-375. The exact sequence is proprietary. (NP_079094.1)
    Sequence:

    QEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPVPDLPEGITV AYTIP


    Database link: Q9GZZ9

  • Positive control
    • Jurkat, 293T and HeLa whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 - 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 45 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    E1-like enzyme which activates UFM1 and SUMO2.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family. UBA5 subfamily.
  • Cellular localization
    Cytoplasm. Nucleus. Localizes mainly in cytoplasm, while it mainly localizes to the nucleus in presence of SUMO2.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5730525G14Rik antibody
    • AW240750 antibody
    • FLJ23251 antibody
    • FLJ23251UBA5 antibody
    • MGC105565 antibody
    • ThiFP1 antibody
    • UBA5 antibody
    • UBA5 ubiquitin activating enzyme E1 homolog antibody
    • UBA5_HUMAN antibody
    • UBE1DC antibody
    • UBE1DC1 antibody
    • Ubiquitin activating enzyme 5 antibody
    • Ubiquitin activating enzyme E1 domain containing 1 antibody
    • Ubiquitin activating enzyme E1 domain containing protein 1 antibody
    • Ubiquitin like modifier activating enzyme 5 antibody
    • Ubiquitin-activating enzyme 5 antibody
    • Ubiquitin-activating enzyme E1 domain-containing protein 1 antibody
    • Ubiquitin-like modifier-activating enzyme 5 antibody
    • UFM1 activating enzyme antibody
    • UFM1-activating enzyme antibody
    see all

Images

  • All lanes : Anti-UBA5 antibody (ab177507) at 0.4 µg/ml

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : HeLa whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 45 kDa


    Exposure time: 30 seconds
  • Detection of UBA5 in Immunoprecipitates of Jurkat whole cell lysates (1 mg for IP, 20% of IP loaded) using ab177507 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab177507 was used at 1 µg/ml. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab177507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up