Anti-UBAP1 antibody (ab223789)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-UBAP1 antibody
See all UBAP1 primary antibodies -
Description
Rabbit polyclonal to UBAP1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human UBAP1 aa 10-109.
Sequence:FHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLE KKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHS
Database link: Q9NZ09 -
Positive control
- IHC-P: Human pancreas tissue. ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab223789 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studied as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. -
Cellular localization
Cytoplasm; cytosol. Endosome. Note: Predominantly cytosolic. Recruited to endosomes as part of the ESCRT-I complex. -
Database links
- Entrez Gene: 51271 Human
- Omim: 609787 Human
- SwissProt: Q9NZ09 Human
- Unigene: 268963 Human
-
Alternative names
- MGC8710 antibody
- NAG20 antibody
- Nasopharyngeal carcinoma associated gene 20 protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBAP1 antibody (ab223789)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for UBAP1 (green) using ab223789 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBAP1 antibody (ab223789)Paraffin-embedded human pancreas tissue stained for UBAP1 using ab223789 at 1/1000 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab223789 has not yet been referenced specifically in any publications.
