Overview

  • Product name

  • Description

    Rabbit polyclonal to UBASH3A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human UBASH3A aa 119-320. (BC069511).
    Sequence:

    CEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADV IREFAMTFATEASLLADCSVKPCTKQLHLTLAHKFYPHHQRTLEQLARAI PLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVD PTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLA TD


    Database link: P57075-2

  • Positive control

    • Human fetal heart lysate; Human fetal spleen tissue.

Properties

  • Form

    Lyophilised:Add 200ul Steriled Distilled Water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 59 kDa (predicted molecular weight: 59, 70, 74 kDa).
IHC-P 1/100 - 1/500.

Target

  • Function

    Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.
  • Tissue specificity

    Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow.
  • Sequence similarities

    Contains 1 SH3 domain.
    Contains 1 UBA domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cbl interacting protein 4 antibody
    • Cbl-interacting protein 4 antibody
    • CLIP4 antibody
    • STS 2 antibody
    • STS-2 antibody
    • Suppressor of T cell receptor signaling 2 antibody
    • Suppressor of T-cell receptor signaling 2 antibody
    • T cell ubiquitin ligand antibody
    • T cell ubiquitin ligand protein antibody
    • T-cell ubiquitin ligand 1 antibody
    • TULA antibody
    • TULA-1 antibody
    • UBASH3A antibody
    • ubiquitin associated and SH3 domain containing, A antibody
    • Ubiquitin-associated and SH3 domain-containing protein A antibody
    • UBS3A_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of Formalin-fixed, Paraffin-embedded Human fetal spleen tissue labeling UBASH3A with ab197168 at 1/100 dilution.

  • Anti-UBASH3A antibody (ab197168) at 1/500 dilution + Human fetal heart lysate

    Predicted band size: 59, 70, 74 kDa

References

ab197168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up