Anti-UBC4 antibody (ab246870)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-UBC4 antibody
See all UBC4 primary antibodies -
Description
Rabbit polyclonal to UBC4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Guinea pig
-
Immunogen
Recombinant fragment corresponding to Human UBC4 aa 10-91.
Sequence:LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD YPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Database link: P62837 -
Positive control
- WB: RT4, U-251 MG, NIH/£t£ andNBT-II whole cell lysates. IHC-P: Human breast tissue. ICC/IF: U-2512 MG cells.
-
General notes
This product was previously labelled as UBE2D2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246870 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 17 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Belongs to the ubiquitin-conjugating enzyme family. - Information by UniProt
-
Database links
- Entrez Gene: 7322 Human
- Entrez Gene: 56550 Mouse
- Entrez Gene: 641452 Rat
- Omim: 602962 Human
- SwissProt: P62837 Human
- SwissProt: P62838 Mouse
- SwissProt: P62839 Rat
- Unigene: 108332 Human
see all -
Alternative names
- E2(17)KB2 antibody
- OTTHUMP00000223475 antibody
- OTTHUMP00000223476 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-UBC4 antibody (ab246870)PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for UBC4 (green) using ab246870 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBC4 antibody (ab246870)Paraffin-embedded human breast tissue stained for UBC4 using ab246870 at 1/20 dilution in immunohistochemical analysis.
-
Western blot - Anti-UBC4 antibody (ab246870)All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 17 kDa -
Western blot - Anti-UBC4 antibody (ab246870)All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate
Predicted band size: 17 kDa
Datasheets and documents
References
ab246870 has not yet been referenced specifically in any publications.
