For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ubc4-antibody-ab246870.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Ubiquitin & Ubiquitin Like Modifiers E2 Ubiquitin Conjugating Enzymes
Share by email

Anti-UBC4 antibody (ab246870)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-UBC4 antibody (ab246870)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBC4 antibody (ab246870)
  • Western blot - Anti-UBC4 antibody (ab246870)
  • Western blot - Anti-UBC4 antibody (ab246870)

Key features and details

  • Rabbit polyclonal to UBC4
  • Suitable for: IHC-P, WB, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human UBC4 protein (ab109971)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-UBC4 antibody
    See all UBC4 primary antibodies
  • Description

    Rabbit polyclonal to UBC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Guinea pig
  • Immunogen

    Recombinant fragment corresponding to Human UBC4 aa 10-91.
    Sequence:

    LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD YPFKPPKVAFTTKIYHPNINSNGSICLDILRS


    Database link: P62837
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: RT4, U-251 MG, NIH/£t£ andNBT-II whole cell lysates. IHC-P: Human breast tissue. ICC/IF: U-2512 MG cells.
  • General notes

     This product was previously labelled as UBE2D2

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • E2 Ubiquitin Conjugating Enzymes
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Ubiquitin E2 Enzymes

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Positive Controls

    • NIH 3T3 whole cell lysate (ab7179)
  • Recombinant Protein

    • Recombinant Human UBC4 protein (ab109971)
  • Related Products

    • Recombinant Human UBC4 protein (ab109971)

Applications

Our Abpromise guarantee covers the use of ab246870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 17 kDa.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Target information above from: UniProt accession P62837 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 7322 Human
    • Entrez Gene: 56550 Mouse
    • Entrez Gene: 641452 Rat
    • Omim: 602962 Human
    • SwissProt: P62837 Human
    • SwissProt: P62838 Mouse
    • SwissProt: P62839 Rat
    • Unigene: 108332 Human
    • Unigene: 180052 Mouse
    • Unigene: 7390 Rat
    see all
  • Alternative names

    • E2(17)KB2 antibody
    • OTTHUMP00000223475 antibody
    • OTTHUMP00000223476 antibody
    • OTTHUMP00000223477 antibody
    • OTTHUMP00000223478 antibody
    • OTTHUMP00000224375 antibody
    • PUBC 1 antibody
    • PUBC1 antibody
    • UB2D2_HUMAN antibody
    • UBC 4 antibody
    • UBC 4/5 antibody
    • UBC4 antibody
    • UBC4/5 antibody
    • UBC4/5 homolog yeast antibody
    • UBCH 5B antibody
    • UBCH5B antibody
    • UBE2D2 antibody
    • Ubiquitin carrier protein antibody
    • Ubiquitin carrier protein D2 antibody
    • Ubiquitin conjugating enzyme E2 17 kDa 2 antibody
    • Ubiquitin conjugating enzyme E2 D2 antibody
    • Ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) antibody
    • Ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog yeast) antibody
    • Ubiquitin conjugating enzyme E2D 2 antibody
    • Ubiquitin protein ligase D2 antibody
    • Ubiquitin-conjugating enzyme E2 D2 antibody
    • Ubiquitin-conjugating enzyme E2(17)KB 2 antibody
    • Ubiquitin-conjugating enzyme E2-17 kDa 2 antibody
    • Ubiquitin-protein ligase D2 antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-UBC4 antibody (ab246870)
    Immunocytochemistry/ Immunofluorescence - Anti-UBC4 antibody (ab246870)

    PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for UBC4 (green) using ab246870 at 4 μg/ml in ICC/IF.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBC4 antibody (ab246870)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBC4 antibody (ab246870)

    Paraffin-embedded human breast tissue stained for UBC4 using ab246870 at 1/20 dilution in immunohistochemical analysis.

  • Western blot - Anti-UBC4 antibody (ab246870)
    Western blot - Anti-UBC4 antibody (ab246870)
    All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate

    Predicted band size: 17 kDa

  • Western blot - Anti-UBC4 antibody (ab246870)
    Western blot - Anti-UBC4 antibody (ab246870)
    All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate

    Predicted band size: 17 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab246870? Please let us know so that we can cite the reference in this datasheet.

    ab246870 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab246870.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.