Anti-UBC4 antibody (ab246870)
Key features and details
- Rabbit polyclonal to UBC4
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-UBC4 antibody
See all UBC4 primary antibodies -
Description
Rabbit polyclonal to UBC4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Guinea pig -
Immunogen
Recombinant fragment corresponding to Human UBC4 aa 10-91.
Sequence:LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD YPFKPPKVAFTTKIYHPNINSNGSICLDILRS
Database link: P62837 -
Positive control
- WB: RT4, U-251 MG, NIH/£t£ andNBT-II whole cell lysates. IHC-P: Human breast tissue. ICC/IF: U-2512 MG cells.
-
General notes
This product was previously labelled as UBE2D2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246870 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 17 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Belongs to the ubiquitin-conjugating enzyme family. - Information by UniProt
-
Database links
- Entrez Gene: 7322 Human
- Entrez Gene: 56550 Mouse
- Entrez Gene: 641452 Rat
- Omim: 602962 Human
- SwissProt: P62837 Human
- SwissProt: P62838 Mouse
- SwissProt: P62839 Rat
- Unigene: 108332 Human
see all -
Alternative names
- E2(17)KB2 antibody
- OTTHUMP00000223475 antibody
- OTTHUMP00000223476 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for UBC4 (green) using ab246870 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UBC4 antibody (ab246870)
Paraffin-embedded human breast tissue stained for UBC4 using ab246870 at 1/20 dilution in immunohistochemical analysis.
-
All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 17 kDa -
All lanes : Anti-UBC4 antibody (ab246870) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate
Predicted band size: 17 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246870 has not yet been referenced specifically in any publications.