Overview

  • Product name

    Anti-UBE2C antibody [1F5D3]
    See all UBE2C primary antibodies
  • Description

    Mouse monoclonal [1F5D3] to UBE2C
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human UBE2C aa 1-179.
    Sequence:

    MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGI SAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT HAAELWKNPTAFKKYLQETYSKQVTSQEP


    Database link: O00762

  • Positive control

    • Human liver cancer tissue and esophageal cancer tissue. UBE2C transfected HEK293 cell lysate. Recombinant human UBE2C.

Properties

Applications

Our Abpromise guarantee covers the use of ab201979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 20 kDa.

Target

  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Post-translational
    modifications

    Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cyclin selective ubiquitin carrier protein antibody
    • dJ447F3.2 antibody
    • Mitotic specific ubiquitin conjugating enzyme antibody
    • UB E2C antibody
    • UBCH 10 antibody
    • UbcH10 antibody
    • UBE 2C antibody
    • Ube2c antibody
    • UBE2C_HUMAN antibody
    • Ubiquitin carrier protein C antibody
    • Ubiquitin carrier protein E2 C antibody
    • Ubiquitin carrier protein E2C antibody
    • Ubiquitin conjugating enzyme E2 C antibody
    • Ubiquitin conjugating enzyme E2C antibody
    • Ubiquitin protein ligase C antibody
    • Ubiquitin-conjugating enzyme E2 C antibody
    • Ubiquitin-protein ligase C antibody
    see all

Images

  • Anti-UBE2C antibody [1F5D3] (ab201979) at 1/500 dilution + recombinant UBE2C protein

    Predicted band size: 20 kDa

  • All lanes : Anti-UBE2C antibody [1F5D3] (ab201979) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : UBE2C transfected HEK293 cell lysate

    Predicted band size: 20 kDa

  • Immunohistochemical analysis of paraffin-embedded human liver cancer tissues labeling UBE2C using ab201979 at 1/200 dilution followed by DAB staining.

  • Immunohistochemical analysis of paraffin-embedded human esophageal cancer tissues labeling UBE2C using ab201979 at 1/200 dilution followed by DAB staining.

References

This product has been referenced in:

  • Ma R  et al. High expression of UBE2C is associated with the aggressive progression and poor outcome of malignant glioma. Oncol Lett 11:2300-2304 (2016). Read more (PubMed: 26998166) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up