Overview

  • Product name
    Anti-UBE2E2 antibody - N-terminal
    See all UBE2E2 primary antibodies
  • Description
    Rabbit polyclonal to UBE2E2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Ferret, Rhesus monkey, Orangutan, Bat
  • Immunogen

    Synthetic peptide within Human UBE2E2 aa 1-25 (N terminal). The exact sequence is proprietary.
    Sequence:

    MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTA


    Database link: Q96LR5

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 22 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ25157 antibody
    • UB2E2_HUMAN antibody
    • UBC4/5 homolog yeast antibody
    • UBCH 8 antibody
    • UbcH8 antibody
    • Ube2e2 antibody
    • Ubiquitin carrier protein E2 antibody
    • Ubiquitin conjugating enzyme E2 E2 antibody
    • Ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5) antibody
    • Ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog yeast) antibody
    • Ubiquitin conjugating enzyme E2E 2 antibody
    • Ubiquitin protein ligase E2 antibody
    • Ubiquitin-conjugating enzyme E2 E2 antibody
    • Ubiquitin-protein ligase E2 antibody
    see all

Images

  • All lanes : Anti-UBE2E2 antibody - N-terminal (ab176703) at 0.04 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : Jurkat whole cell lysate at 50 µg
    Lane 4 : HeLa whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 22 kDa


    Exposure time: 3 minutes
  • Detection of UBE2E2 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176703 at 6 µg/mg lysate for IP and at 0.04 µg/ml for subsequent Western blot detection.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

     

References

ab176703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up